LL-37 5mg | 10-Vial Kit | Antimicrobial Peptide Kit

$100.00

LL-37 (Cathelicidin antimicrobial peptide) — ≥99% HPLC purity, MS confirmed, Janoshik COA. Research use only.

Category:

Description

Buy LL-37 5mg Online: Research Buyer’s Guide to the Human Cathelicidin Peptide

LL-37 5mg is a smaller research-sized vial of the synthetic human cathelicidin antimicrobial peptide, the only cathelicidin found in humans. Supplied as a lyophilized powder, it corresponds to the active C-terminal fragment of the precursor protein hCAP-18. LL-37 is studied for its broad-spectrum antimicrobial activity, biofilm effects, immune modulation, and roles in wound-healing models. It is not FDA-approved for any medical, diagnostic, or therapeutic purpose and is sold strictly for laboratory research use.

What Is LL-37?

LL-37 is a 37-amino-acid cationic amphipathic peptide with the sequence
[LL-37, 37 aa]
Molecular weight is approximately 4493 g/mol. It is naturally expressed by neutrophils, epithelial cells, and other immune cells as part of the innate host-defense system.

Research has explored LL-37 for:

  • Direct membrane-disrupting antimicrobial action against bacteria (including some resistant strains), certain viruses, and fungi.
  • Disruption or inhibition of bacterial biofilms.
  • Modulation of innate immune signaling pathways and chemotaxis of immune cells.
  • Support of keratinocyte migration, angiogenesis, and re-epithelialization in experimental wound models.
  • Potential influences on inflammation and epithelial barrier function.

Limited clinical data exist, most notably a randomized placebo-controlled trial of topical LL-37 in hard-to-heal venous leg ulcers that showed improved healing parameters in some subgroup analyses with acceptable local tolerability. Broader systemic therapeutic claims lack robust, large-scale human evidence. Most supporting data remain preclinical or observational.

Why Choose the 5mg Vial?

The 5mg lyophilized vial is a convenient research size for smaller-scale experiments, pilot studies, or laboratories that prefer lower material quantities per order. Typical commercial specifications include:

  • Purity ≥98–99%+ by HPLC (frequently confirmed by mass spectrometry)
  • White to off-white lyophilized powder
  • Batch-specific Certificate of Analysis (COA)
  • Storage recommendations: sealed, protected from light and moisture; long-term at –20°C; reconstituted solutions refrigerated and used promptly under sterile conditions

Vendors present the 5mg format alongside larger sizes (such as 10mg) and emphasize research-only status.

How to Buy LL-37 5mg Online Safely

When searching for “buy LL-37 5mg online,” focus on analytical quality and transparent research positioning rather than the lowest price alone. Key evaluation criteria:

  1. Third-party testing and COA — Prefer suppliers that publish batch-specific HPLC purity, molecular identity confirmation, and (when available) endotoxin results.
  2. Purity and identity verification — Confirm ≥99% HPLC purity claims and that the sequence and molecular weight match established LL-37 specifications.
  3. Clear research-use-only labeling — Legitimate sources state the product is not for human or veterinary consumption, not a drug or dietary supplement, and not intended to diagnose, treat, cure, or prevent any disease.
  4. Manufacturing and logistics details — Look for information on synthesis method, protective packaging, and handling guidance.
  5. Vendor reputation — Review independent lab reports, consistency of batch quality, and community feedback. Be cautious of unusually low prices or therapeutic marketing language.

Pricing for a single 5mg vial typically falls in a lower range than 10mg vials (often roughly half the cost on a per-milligram basis, though this varies). Bulk or multi-vial options may offer additional savings. Always verify current stock, COA availability, and terms directly on the supplier’s website.

Regulatory note: LL-37 is listed on the FDA’s Category 2 bulk drug substances list due to potential safety concerns, including immunogenicity risks for certain routes. Import rules, availability, and restrictions differ by country and institution. Buyers remain fully responsible for legal compliance and adherence to research protocols.

Research Context: Reconstitution Guidance

Educational materials commonly describe reconstituting a 5mg vial with bacteriostatic or sterile water to create a measurable concentration for laboratory work. Reported research ranges vary widely across literature and commercial sources and do not constitute clinical dosing recommendations. No standardized human systemic dosing has been established through rigorous regulatory pathways.

Researchers must follow institutional biosafety procedures, maintain sterility, use appropriate personal protective equipment, and document all steps.

Safety, Limitations, and Realistic Expectations

As an endogenous immunomodulatory peptide, LL-37 carries theoretical risks of local irritation, injection-site reactions in experimental models, immune activation, and potential concerns in individuals with certain inflammatory or autoimmune skin conditions (associations with psoriasis and rosacea appear in the literature). Topical applications in limited clinical settings have generally been well tolerated locally, but comprehensive systemic safety data remain limited.

LL-37 is not an approved medication. Claims of treating infections, supporting “Lyme recovery,” providing broad immune enhancement, or delivering anti-aging benefits exceed the current evidence base. Always consult qualified professionals and institutional review processes for any research involving this compound.

Final Considerations Before Ordering

Purchasing LL-37 5mg online is straightforward through specialized research peptide suppliers that emphasize third-party testing, clear Certificates of Analysis, and explicit research-only disclaimers. Prioritize analytical transparency and avoid vendors that make medical claims. Treat the material strictly as a laboratory research tool, stay informed about the limited clinical evidence and regulatory status, and prioritize safety, legality, and proper documentation.

For the latest batch testing results or supplier comparisons, consult recent independent laboratory reports and peptide research databases. Confirm that any product matches the established chemical identity and specifications of human cathelicidin LL-37 before purchase.

Reviews

There are no reviews yet.

Be the first to review “LL-37 5mg | 10-Vial Kit | Antimicrobial Peptide Kit”

Your email address will not be published. Required fields are marked *

Add to cart