Description
Buy LL-37 10mg Online: Research Guide to the Human Cathelicidin Antimicrobial Peptide
LL-37 10mg is a synthetic version of the only human cathelicidin antimicrobial peptide, supplied as a lyophilized powder vial by research peptide vendors. It corresponds to the active C-terminal fragment of the precursor protein hCAP-18 and is studied for its roles in innate immune defense, membrane disruption of microbes, immune modulation, and tissue repair models. LL-37 is not FDA-approved for any medical, diagnostic, or therapeutic use and is sold strictly for laboratory research purposes.
What Is LL-37?
LL-37 is a 37-amino-acid cationic amphipathic peptide with the sequence
[LL-37, 37 aa]
Its molecular formula is approximately C₂₀₅H₃₄₀N₆₀O₅₃ and its molecular weight is about 4493 g/mol. It is the mature form of the sole human cathelicidin and is naturally produced by neutrophils, epithelial cells, and other immune cells in response to infection or vitamin D signaling.
In research settings, LL-37 has been examined for:
- Direct antimicrobial activity against Gram-positive and Gram-negative bacteria, certain viruses, and fungi through membrane disruption.
- Inhibition or disruption of bacterial biofilms.
- Modulation of innate immune signaling (including effects on TLR pathways and chemotaxis of immune cells).
- Promotion of keratinocyte migration, angiogenesis, and re-epithelialization in wound-healing models.
- Potential influences on inflammation and host-defense responses.
A randomized, placebo-controlled clinical trial on topical LL-37 for hard-to-heal venous leg ulcers reported improved healing rates in some analyses (particularly larger wounds) with good local tolerability, though overall efficacy signals were mixed and further confirmation is needed. Most other data remain preclinical or observational. Systemic therapeutic use in humans lacks robust, large-scale evidence.
Why the 10mg Vial?
The 10mg lyophilized vial is a standard research size. It allows precise reconstitution for in-vitro assays, membrane biophysics studies, antimicrobial mechanism research, and related laboratory work. Common commercial specifications include:
- Purity ≥98–99%+ verified by HPLC (often with mass spectrometry identity confirmation)
- White to off-white lyophilized powder
- Batch-specific Certificate of Analysis (COA)
- Storage guidance: sealed and protected from light/moisture; long-term at –20°C; reconstituted material refrigerated and used within a limited window
Vendors typically emphasize that the product is for research use only and must be reconstituted before laboratory application.
How to Buy LL-37 10mg Online Responsibly
When searching for “buy LL-37 10mg online,” prioritize quality documentation and transparent research-only positioning over the lowest price. Key evaluation points:
- Third-party testing and COA — Request or review batch-specific HPLC purity, mass confirmation, and (where available) endotoxin data. Reputable suppliers publish these openly.
- Purity and identity claims — Look for ≥99% HPLC purity and clear sequence/molecular weight verification matching the known LL-37 profile.
- Research-use-only labeling — Legitimate sources state the material is not for human or veterinary consumption, not a drug or supplement, and not intended to diagnose, treat, cure, or prevent any condition.
- Manufacturing and shipping practices — Prefer vendors that note synthesis method, cold-chain or protective packaging options, and clear handling instructions.
- Reputation and consistency — Cross-check independent lab reports, community discussions of batch quality, and consistency across lots. Extremely low prices or aggressive therapeutic claims are red flags.
Market prices for a single 10mg vial commonly range from roughly $50 to $180 depending on testing depth, origin claims, and volume discounts. Bulk kits are often available. Always verify current stock, COA availability, and terms on the supplier’s site.
Legal and regulatory note: LL-37 appears on the FDA’s Category 2 list of bulk drug substances that may present significant safety risks (including potential immunogenicity concerns). Availability, import rules, and compounding restrictions vary by jurisdiction. Purchasers are solely responsible for compliance with applicable laws and institutional research protocols.
Safety, Limitations, and Realistic Expectations
Because LL-37 is an endogenous human peptide with immunomodulatory activity, theoretical concerns include local irritation, injection-site reactions (in research models), potential immune activation, and risks in individuals with certain autoimmune or inflammatory skin conditions (e.g., psoriasis or rosacea associations in the literature). Topical applications in limited clinical settings have generally shown acceptable local tolerability, but systemic safety data remain sparse.
LL-37 is not approved as a drug. Claims of broad infection treatment, “Lyme support,” anti-aging, or systemic immune enhancement exceed the current evidence base and should be treated with caution. Consult qualified professionals and institutional review processes for any research involving this compound.
Final Considerations Before Ordering
Buying LL-37 10mg online is feasible through specialized research peptide suppliers that provide third-party testing, clear COAs, and explicit research-only disclaimers. Focus on vendors that prioritize analytical transparency and avoid medical marketing language. Treat the material strictly as a laboratory research tool, remain aware of the limited clinical evidence and regulatory status, and prioritize safety, legality, and documentation.
For the most current batch testing or supplier comparisons, review recent independent lab reports and peptide research databases. Always confirm the product’s chemical identity against the established LL-37 sequence and specifications before purchase.








Reviews
There are no reviews yet.